PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0118s0081.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 487aa    MW: 52648.1 Da    PI: 9.7887
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0118s0081.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.32.7e-32201258159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ++DgynWrKYGqK+vkgse+prsYY+Ct+ +Cpvkkkvers  +++++ei+Y+g+Hnhe
  Kalax.0118s0081.1.p 201 VEDGYNWRKYGQKQVKGSEYPRSYYKCTHFHCPVKKKVERSP-QGQIIEIIYKGQHNHE 258
                          58****************************************.9**************8 PP

2WRKY105.62.7e-33377435159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDg++WrKYGqK+vkg+ +prsYY+Ct++gC+v+k+ver++ dpk+v++tYeg+Hnh+
  Kalax.0118s0081.1.p 377 LDDGFRWRKYGQKVVKGNSHPRSYYKCTTPGCNVRKHVERASADPKAVITTYEGKHNHD 435
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.056196260IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-28198259IPR003657WRKY domain
SuperFamilySSF1182902.62E-25199259IPR003657WRKY domain
SMARTSM007741.7E-34201259IPR003657WRKY domain
PfamPF031064.1E-25202258IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.8E-36363436IPR003657WRKY domain
SuperFamilySSF1182901.05E-28369436IPR003657WRKY domain
PROSITE profilePS5081135.485372437IPR003657WRKY domain
SMARTSM007747.8E-40377436IPR003657WRKY domain
PfamPF031066.2E-26378435IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MAKNQLSSAS AVSSTHHHPP RPATIALPPR TAAENLFASG FAGFSPGPMT LASSLFPADA  60
ADPRSFSQLL AGAMASPLPD KSDSKYKQNR PLNLEVSPSP IFMVPPGFSP SGLLNSPGIF  120
SPAQSPFGMS HQQALAQVTA QAALAQSNMQ LQANQTPFAN PPESYKPPST TEPKIASIAP  180
SELALSVPKS QPALAAPDKP VEDGYNWRKY GQKQVKGSEY PRSYYKCTHF HCPVKKKVER  240
SPQGQIIEII YKGQHNHEQT PPKKPAKDGN APIENVGAQA TPDVHQPELD RAEAPKRPME  300
TALEQIVNGK DQKFLQEASI DSRPLTTDET RGKADNDNGP VLKKRNTGSP AAEPTLPQKT  360
VVEPKIVVQT RSEVDLLDDG FRWRKYGQKV VKGNSHPRSY YKCTTPGCNV RKHVERASAD  420
PKAVITTYEG KHNHDTQEGR SNSRGPPHPK SQTVAAERHT VANEIEPTKN GQTGVAAPQL  480
QEKVNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-39201435875Probable WRKY transcription factor 4
2lex_A7e-39201435875Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661104.11e-158PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI901e-130WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLF6H5W31e-157F6H5W3_VITVI; Putative uncharacterized protein
STRINGVIT_14s0108g01280.t011e-157(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-121WRKY DNA-binding protein 4